PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Brast02G021900.2.p
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; BOP clade; Pooideae; Brachypodieae; Brachypodium
Family TALE
Protein Properties Length: 463aa    MW: 49203.4 Da    PI: 7.9896
Description TALE family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Brast02G021900.2.pgenomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Homeobox26.51.1e-081962331954
                         HHH..SSS--HHHHHHHHHHCTS-HHHHHHHHHHHHHH CS
            Homeobox  19 Fek..nrypsaeereeLAkklgLterqVkvWFqNrRak 54 
                         Fe   ++yps  ++  L++++gL+ +qV++WF N R +
  Brast02G021900.2.p 196 FEHflHPYPSDVDKHILSRQTGLSRSQVSNWFINARVR 233
                         554459******************************88 PP

2BELL67.82e-22671221772
                BELL  17 eeVdkrYkqyveqlqtvissFeavaglgsakpYtslAlkaiSrhFrcLkdaiaeqi 72 
                         + Vd+rY++y+eq++ +++ Feavag  +a+ Yt+lA+++iSrhFr+L+d ++ q+
  Brast02G021900.2.p  67 QLVDRRYRRYCEQMRGLAGGFEAVAGERAAAGYTALASRTISRHFRSLRDGVVAQL 122
                         679**************************************************996 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SMARTSM005747.5E-61120IPR006563POX domain
PfamPF075265.7E-2057118IPR006563POX domain
PROSITE profilePS5007111.629174237IPR001356Homeobox domain
SMARTSM003891.6E-8177241IPR001356Homeobox domain
CDDcd000867.70E-12177238No hitNo description
SuperFamilySSF466895.99E-17178244IPR009057Homeodomain-like
Gene3DG3DSA:1.10.10.602.8E-27180243IPR009057Homeodomain-like
PfamPF059201.6E-17194233IPR008422Homeobox KN domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 463 aa     Download sequence    Send to blast
MDTLLASSTS PDIYVGTKAT AGGRPGAKLL ETQQQQQQQQ RQGEAKARRQ PPPADGRRAQ  60
AIAHSHQLVD RRYRRYCEQM RGLAGGFEAV AGERAAAGYT ALASRTISRH FRSLRDGVVA  120
QLQAVRKALG EKDSSSSKSP GGMTRGDTPR LKVLDQCIRQ HKAMHQNGGL LMETHPWRPQ  180
RGLPERAVTV LRAWLFEHFL HPYPSDVDKH ILSRQTGLSR SQVSNWFINA RVRLWKPMVE  240
EMYVEEMKDD GGAQGHEGQV VVDASAANNN PSSGSNQLVQ GDGGEQKPTR AQLRHADADA  300
DIGVAAHGRH DAGSLASVVN VGRMGMESFA DMDGHGHFGF DAYDTADADA GPSAGFGGGG  360
GVSLTLGLQQ HDSRGDHGGV NIAFGAPGPA HGGYLFPGDH QQQMGMLHTS AGHGHHIQFG  420
AGGGMADSSA GDASNGAGHV DAQQYRWLSA AGSSSLLRDM TG*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
5bng_A7e-17183241159Homeobox protein Meis2
5bng_B7e-17183241159Homeobox protein Meis2
Search in ModeBase
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_014752259.10.0PREDICTED: homeobox protein BEL1 homolog
RefseqXP_010229286.10.0PREDICTED: homeobox protein BEL1 homolog
RefseqXP_003562164.10.0PREDICTED: homeobox protein BEL1 homolog
TrEMBLI1HAB90.0I1HAB9_BRADI; Uncharacterized protein
STRINGBRADI1G76940.10.0(Brachypodium distachyon)
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT4G36870.24e-76BEL1-like homeodomain 2